GenomeNet

>dmo:Dmoj_GI22805 K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] | (RefSeq) uncharacterized protein, isoform A (A)
MIMVRRRARPVKEAALVVVTSDRVASNSDSALALPFNGEPISAVAAAATNNLLDDQYFAS
PKRKDCRLMKAHENLSKDKNGKANGGNSTKSETDRIIGVQLATRSQTRTIENFFKASAAA
KSKKKNGALSETSVGKETIAEKKTITLIDELEVDEEEELLLYDQHSIASPSTSTSSPAYQ
NDDLEVENSYDPGCNYTPTDIDTHIQIDAHTQTETGIPTDTHTQTEQRDESPTNTTAFQT
HRSALRDSHSSSHSSSSAATSDNIFLQEPVLTLDIDRTPTKASSIRINKSFELANAVFSS
PPSVLSACVLNGRFNQIVTLNGHGHGHGEEVEHEQEQHQMQQPLGGYELDQHDSSSCDSG
VACSLTTGTSPAVAANRRRKPATPHRILCPSPIKTMPRDTALVKGETLSPRKSPRKLQMQ
LAASGASKSRRRLNQPKPQAPYQQQQQQQQQHNHISNEDVVLVDDEDEEDDVHALLKAAE
ERENLNKTKAMLKPAAVTATAAAKPKASSTKPAKAKTMAAKSVPLAATNGNREMTEFFPV
RRSVRKTKTAVKEEMMRNLEQAVLEERCDGLQVRHFMGKGRGVVAIRRFKRNEFVVEYVG
DLISISEATERERRYALDENAGCYMYYFKHKNQQYCIDATIDTGKLGRLINHSRNGNLVT
KVVVIKQRPHLVLLAKDDIEIGEELTYDYGDRSKESLLHHPWLAF

BLAST