GenomeNet

>dor:Desor_4591 2-oxoacid:ferredoxin oxidoreductase subunit alpha; K00169 pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1] (A)
MSTTLLTGSEAAAYGAKLARIEVLAYYPITPAFPAMERISKFIDEGDLNTRFVRVESDHS
ALAAALGASLAGSRTFTVTNSQGLLYMTEVVYHTAGLRQPVVMAVANRALSAPHSRFPEQ
GDAISQGASGWIQLFCENNQEVLDTTLQAFKIAETVRLPVMVNYEGYIQSHTMEEVGIPG
QEKIDQFLPLKRVRTLDVENPQAVNTVASPEFYMDYKFRQNEAMDQALTVIDSVASDFAQ
EFGRDWFGLIDTYQMDDAEHAIVAMGSMVSDARIVVDELRNEGRKIGLVKIRTWRPFPAE
ALRKVLEKVQLITVFDKNIVYGLGGALGTELRSALYGQSARLNSYILGLGGRDVTTEEIK
KVLELSEKTEKQAAASEWFGL

BLAST