GenomeNet

>dosa:Os01t0949700-01 K00799 glutathione S-transferase [EC:2.5.1.18] | (RAP-DB) Os01g0949700, TAU_GLUTATHIONE_S-TRANSFERASE_7, GSTU7; Glutathione S-transferase, C-terminal domain containing protein. (A)
MMNSSEPVKLIGAFGSPFVHRVEVALRLKGVPYELILEDMGNKSELLLAHNPVHKMVPVL
LHGDRSAICESLVIVEYVDEAFDGPPLLPADPLRRAMARFWVHFLDENCLKPLRPALFGE
GEEQKKSMEETREGLTVAEAELRGKRFSGGSSIGLADIAGGGVLAHWVGVLQEVAGVSVL
SDGDGEYPALRRWAKDYVANESVMECLPDRDRLLSYFTGIKQKCVSVAKSTLPKYSLLP

BLAST