GenomeNet

>dosa:Os03t0113100-01 Os03g0113100; Similar to Thymidine kinase.; K00857 thymidine kinase [EC:2.7.1.21] (A)
MSSICAMRSLLAASTFLRSGASPLLRPLSRPLPSRLNLSRFGPVRPVSAAAAAADKSRGG
GGSAMEAQPSYPGEIHVIVGPMFAGKTTALLRRVQVEAGTGSRNVALIKSDKDNRYGLDS
VVTHDGTKMPCWALPELSSFQDKLGTEAYDKVDVIGIDEAQFFDDLHDFCCKAADRDGKI
VVVAGLDGDYKRNKFGSVLDIIPLADSVTKLTARCELCGRRAFFTLRKTRETKTELIGGA
DVYMPVCRQHYLDGQIVIEATRIVLDLEKSKVIHAFK

BLAST