GenomeNet

>dosa:Os03t0283200-00 K00799 glutathione S-transferase [EC:2.5.1.18] | (RAP-DB) Os03g0283200, GSTL1, LAMBDA_GLUTATHIONE_S-TRANSFERASE_1; Similar to IN2-1 protein. (A)
MAAAAAPRSSGKEALPAALGSASEPPRLFDGTTRLYICYFCPFAQRAWIIRNFKGLQDKI
ELVGIDLQDKPAWYKEKVYEQGTVPSLEHNGKIMGESLDLIKYIDSHFEGPALLPEDPEK
RQFADELIAYANAFTKALYSPLISKADLSAETVAALDKIEAALSKFGDGPFFLGQFSLVD
IAYVTIIERIQIYYSHIRKYEITNGRPNLEKFIEEINRIEAYTQTKNDPLYLLDLAKTHL
KVA

BLAST