GenomeNet

>dosa:Os04t0540600-01 K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] | (RAP-DB) Os04g0540600; Aldehyde dehydrogenase domain containing protein. (A)
MGRVAPSVEEVGGEQPPPALGPGETVSGTVAELRAAYESGRTRSLEWRQSQLRGLLRLLA
EEEAAAFRALREDLGKHQAEAYRDEIGVLVKSANAALREVGKWMAPEKVWVPLIAFPARA
QLEPQPLGVILVFSCWNVPLGLSLEPLVGALAAGNAVALKPSELAPATAKFLGDNVGKYM
DATAVKVIQGGPEVGEQLMEHRWDKVLFTGSPRIARVVMAAAAKHLTPVALELGGKCPCI
FDTIGGSARDLQTAVNRVVGGKWSSCAGQACLAIDYVLVEERFVPVLIKALKSTLKKFFA
DSDHMARIVNARHFQRLSDLLKDKSVAASVLHGGTLDAKNLCIEPTILLNPPLDSAIMTE
EIFGPLLPIITVKKIEDSIAFVRARPRPLAVYAFTKNAALRRRIVEETSSGSVTFNDAVV
QYGIDSLPFGGVGESGFGQYHGKYSFEMFSHKKAVLTRGYLIELTARYPPWDDSKISMMR
QLYRYNYVGFVLTFLGLKK

BLAST