GenomeNet

>dosa:Os07t0435900-01 Os07g0435900; SET domain containing protein.; K11420 euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43] (A)
MEMDTSPSSSAPSSPAASSDSIDLNFLPFLKREPKSEPASPERGPLPLPAAAPPPPPPPP
PPPPPPQVQAATVATPVPATPDLSAAAVMTPLQSLPPNPEEETLLAEYYRLATLYLSSAG
AAGVIVPAAAPEASAGAVAQPGSGSGAKKRRPRSSELVRVSSLSVQDQIYFRDLVRRARI
TFESLRGILLRDDERAEVLGLTGVPGFGAVDRRRVRADLRAAALMGDRDLWLNRDRRIVG
PIPGISVGDAFFFRMELCVLGLHGQVQAGIDFVTAGQSSSGEPIATSIIVSGGYEDDDDR
GDVLVYTGHGGRDPNLHKHCVDQKLEGGNLALERSMAYGIEIRVIRAVKSKRSPVGKVYF
YDGLYKVVDYWLDRGKSGFGVYKYKMLRIEGQESMGSVNFRLAEQLKVNALTFRPTGYLG
FDISMGREIMPVALYNDVDDDRDPLLFEYLARPIFPSSAVQGKFAEGGGGCECTENCSIG
CYCAQRNGGEFAYDKLGALLRGKPLVYECGPYCRCPPSCPNRVSQKGLRNRLEVFRSRET
GWGVRSLDLIKAGTFICEFSGIVLTHQQSEIMAANGDCLVRPSRFPPRWLDWGDVSDVYP
EYVAPNNPAVPDLKFSIDVSRARNVACYFSHSCSPNVFVQFVLFDHYNAAYPHLMIFAME
NIPPLRELSIDYGMIDEWVGKLTM

BLAST