GenomeNet

>dosa:Os09t0315700-01 Os09g0315700; Phosphoenolpyruvate carboxylase family protein.; K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MSAMSAAGGGGGVGKVERLSSIDAQLRQLVPAKLSEDDKLIEYDALLLDRFLDVLHGLHG
DDLKDLVQECYEVAAEYETKHDVQKLDELGNMITSLDPGDSIVIAKAFSHMLNLANLAEE
VQIAYRRRIKLKKGDFADENSAMTESDIEETLKRLVFDLKKSPAEVFDALKSQTVDLVLT
AHPTQSVRRSLLQKHSRIRNCLVQLYSKDITPDDKQELDEALQREIQAAFRTDEIRRTQP
TPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDG
NPRVTPEVTRDVCLLARMMAANLYCSQIEDLMFELSMWRCNEELRSRADDLHRSSKKDAK
HYIEFWKKVPLNEPYRVILSDVRDKLYNTRERSRELLSSGYCDIPEEATLTNVEQLLEPL
ELCYRSLCACGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITTYLGIG
SYREWSEERRQEWLLSELNGKRPLFGPDLPRTDEVADVLDTFHVIAELPADSFGAYVISM
ATAPSDVLAVELLQRECHVKTPLRVVPLFEKLADLESAPAALTRLFSISWYRQRINGKQE
VMIGYSDSGKDAGRLSAAWQMYKAQEQLVKVAKDFGVKLTMFHGRGGTVGRGGGPTHLAI
LSQPPDTINGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPSAPKPEWRAL
LDEMAVVATKEYRSVVFQEPRFVEYFRLATPETEYGRMNIGSRPSKRKPSGGIESLRAIP
WIFAWTQTRFHLPVWLGFGAAFKHALQKDIRNLHMLQEMYNEWPFFRVTLDLIEMVFAKG
NPGIAALYDKLLVSEDLQPLGEKLRANYVETQKLLLQVAGHRDLLEGDPYLKQRLRLRDA
YITTLNVCQAYTLKRIRDPDYHVTLRPHLSKEVMDGSKPAAELVKLNPGSEYAPGLEDTL
ILTMKGIAAGLQNTG

BLAST