GenomeNet

>dosa:Os12t0207600-00 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (RAP-DB) Os12g0207600; Similar to ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit. (A)
MSPQTETKANVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEDNQYIAYVAYPLDLFEEGFVTNMFTSI
VGNIFGFKALRALRLEDLRIPPTYSKTFQGPPHGIQVERDKLNKYDRPLLGCTIKPKLGL
SAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFCAEAIYKSQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTRGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREMTLGFVDLLRDDFIEKDRAR
GIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAAAN
RVALEACVQARNEGRDLAREGNEIIRSACKWSPELAAACEIWKVIKFEFEPVDKLDS

BLAST