GenomeNet

>dosa:Os12t0274700-01 Os12g0274700, RUBISCO_SMALL_SUBUNIT, RBCS; Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment).; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MAPSVMASSATTVAPFQGLKSTAGMPVARRSGNSSFGNVSNGGRIRCMQVWPIEGIKKFE
TLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFSKVGFVYRENHRSPGYYDGRYWTMWKLPM
FGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISFIAYKPPGCEESGGN

BLAST