GenomeNet

>dpd:Deipe_3653 K00823 4-aminobutyrate aminotransferase [EC:2.6.1.19] | (GenBank) 4-aminobutyrate aminotransferase family protein (A)
MTFTSIRRPVINTPLPGPKAAELLARDRVRLSTSYMRPYPFVPDFGEGVWLTDVDGNTML
DFMAGIAVSTTGYNHPHVVAAITEQAQRFMHVCLTDYPQEVTTCLAERLIAHVARPGEPW
RAFFGNSGAEAVEAAVKLARNHTGRSHIISTLGSFHGRTYGAITLTGSKTKYKRGFGPLL
PNVSHIPYPNPFRPPLGSTPETCADAVLSYLEDTLFQTVIPADEVAAIIVEPLQGEGGYI
VPPADFLPKLRALCDRHGILLIYDEVQAGMGRSGKFLSYQHFFEGGDVQPDIITMAKGLA
SGMPISCMLARESVMTWPVGSHGSTFGGNPVAAAAALATLDLLEGHVRHPGCGESLMHNA
ANVGDFVLGELRAMQHEFGFLGDVRGKGLFIGLEFVGTNGRADGALRDRASMAMFQRGLL
NLDCGESTIRISPPLILTRNEAGVGLELMREALSSL

BLAST