GenomeNet

>dpe:Dper_GL11120 GL11120 gene product from transcript GL11120-RA; K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MLVNEARQVLSRASSLAARHQLRAISNGTAQLDQQAQPKEAKEPQIKKFEIYRWSPDNAG
EKPHMQTYEVNLRDCGPMVLDALIKIKNEMDPTLTFRRSCREGICGSCAMNIGGINTLAC
ISKIDTNTSKSLKVYPLPHMYVVRDLVPDMNNFYEQYKNIQPWLQRKNEAGEKKGRAQYL
QSVEDRSKLDGLYECILCACCSTSCPSYWWNAEKYLGPAVLMQAYRWIIDSRDENSAERL
SKLKDPFSVYRCHTIMNCTRTCPKGLNPGRAIAEIKKLLAGFASKPAPKLETAALHK

BLAST