GenomeNet

>dpe:Dper_GL25074 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) GL25074 gene product from transcript GL25074-RA (A)
MRLLSVALLKRSTTGLWSIDVRRLHGTAAMRACKEDYAMTDHKYDAIVIGAGGAGMRAGF
GLAEKGFKTALISKLFPTRSHTVAAQGGVNAALSNMDKDDWKYHFYDTVKGSDWLGDQNA
IHYMCREAENAVYELDQFGMPFSRKQDGKIYQRPFGGQTLGYGKGGVARRACAVADRTGH
ALIHTLYGQTLKYADLCHYFIDYFVLDLIMVKGRCAGCLAWKLDDGTMHRFIANNTVVAA
GGCGRVYFSTTAGHTCTGDGNDLASRDVVARAMTMEVLAGNGCGPLKDHVHLQLHHIDPK
IIHERLPGIVVTAKIFAKVDVTKEPVPVLPTVHYNMGGIPTDFMGRVVTVDQECQEQAIE
GLYACGETSCASVHGANRLGANSLLDLIVFGRSCALAIASNNCPGETPPDVDEKATAETL
DNFKKLRCADGKTTTAAIRMELQRTMTGHAAVFREGKLLKKGLLKVADLCQQFKSVKVVD
RSMVWNTDLVETLELQNMLANAVHIITAMENRKESRGSHSREDFKVRLDEFDYSKPLEGQ
KKKKLEEHWRKHTLTFAQGDEGCATIKYREVIDNTLDDTLAPIPPAPRTY

BLAST