GenomeNet

>dpo:Dpse_GA13411 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) Dpse_Gad1; Gad1, isoform A (A)
MSLNPNGYKLSERTGKLTAYDLMPTTVSAGPETQEFLLKVVDVLLDFVKATNDRNEKVLD
FHHPEDLKRLLDLEVPDRALPLQQLIEDCATTLKYQVKTGHPHFFNQLSNGLDLISMAGE
WLTATANTNMFTYEIAPVFILMETVVLTKMREIIGWSGGDSILAPGGSISNLYAFLAARH
KMFPNYKEHGSRGLPGNLAMFTSDQCHYSIKSCAAVCGLGTDHCIVVPSDEHGKMITSEL
ERLILERKAKGDIPFFVNATAGTTVLGAFDDINTIADICEKYNCWMHIDAAWGGGLLMSR
KHRHPRFTGVERADSVTWNPHKLMGALLQCSTIHFKEDGLLISCNQMSAEYLFMTDKHYD
ISYDTGDKVIQCGRHNDIFKLWLQWRAKGTEGFEQQQDRLMELVQYQLKRIRAQSDRFHL
ILEPECVNVSFWYVPKRLRGVPHDARKETELGKICPIIKGRMMQKGSLMVGYQPDDRRPN
FFRSIISSAAVNEADVDFMLDEIHRLGDDL

BLAST