GenomeNet

>dpo:Dpse_GA13730 K15791 probable 2-oxoglutarate dehydrogenase E1 component DHKTD1 [EC:1.2.4.2] | (RefSeq) uncharacterized protein (A)
MKMLRCFSHAETRFAALLFAQTRPQRFYHSEKGVWGYKPIPKRDYQVAEEVRAARNAQAN
VYRLVEAFRQHGHKLATVNPISIKAPVATGQSGTEELQELSPAFYGLQTQETVRTAGLLS
SPQMAQDVAQLEQLLKDIYCGSAVSAEFSYVENLEEREWLARNFESLEQQHQLPDTERRE
IAELLIKSQAWDNFMALKFPTIKRYGGEGAESMLAFFWQLLRDSVQANIEHVVLAMPHRG
RTPLQAALLNMRPAKVFRKLSGASEFGEDIEAMSDVISHFHVSEQLEVLGRPLNFSMVRN
PSHLEAANPVAMGKARSKQQTRGDGAFGPDSQPFGQHVLNVILHGDAAFAGQGINQECLN
MAYVPHFEVGGSLHLIVNNQVGFTTPGDRGRSTAYTSDLAKSIQAPVFHVNGDDPEALAR
ISKLAFRYQREFRKDIFIDLNCFRRWGHNELDDPTFTNPLVYQIVHQRQSVPDLYVQRLA
KEEVLSESQAKEMRDNYMKYLGEELALAPSYQPPPTYFEKQWAGLQLAPSKELTYWDTGV
DYGLLHFIGQQSVSYPADFNIHPHLQKTFVNARLKKLEAGSKIDWATAEALALGSLMYQG
HNIRISGEDVGRGTFSHRHAMLVDQNTNEMFIPLNSMEGGNGGKLELAHSILSEEAVLGF
EYGMAIDNPQNLIIWEAQFGDFANGAQIIIDAFIVSGETKWMESNALVMLLPHGYDGAAS
EHSSCRIERFLQLCDSKETSADGDSVNVHIVSPTTPAQYYHVLRRQLARNFRKPLVVVGP
KTLLRLPAATSTHEDFQPGTLFHNVLGDTKVQADQVRKVVLCSGKHYYALAEEREKRQAY
DTAILRLESLCPFPLQELQAQLAQYGHVQSFVWSQEEHRNMGAWTFVRPRFENLIGQQLH
YCGRYEAPTPATGIGKVHKREVDEIVAAPFEL

BLAST