GenomeNet

>dpo:Dpse_GA14542 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) uncharacterized protein (A)
MGKISLYGLDASPPTRACLLTLKALELPFEYVFVNLLTKENFAEDYMKKNPQHTVPMLQD
DDDYIWDSHAIMAYLVGKYAETDELYPKDLLQRAVVDQRMHFESGVIFEGALRRLTRPVL
FLGGTTLPQANVDQVNEVYDFLETFLDNDFVAGDHLTIADFSIVSSISSLGVYLEHDPVK
YPKTTAWLQRLKELPYYEEANGSGATQFMQLIKSKNFTIVP

BLAST