GenomeNet

>dpo:Dpse_GA16715 K00006 glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8] | (RefSeq) uncharacterized protein, isoform A (A)
MADKISTCIIGSGNWATTIARNVGRNVAAMANTMEPKVYMYVYEEIVEGRKLTEIINTTH
INVKYMPDFVLPENIVAVDDIVTAARDSDILIFAIPPTFVSSCCKTLLGKVKPTAHAVSL
IKGFERGDDGQIILISQIIMRQLKVSCSVMVGCNLAHELANDNFAEGTVGCRDQKYYRVL
RDIFKSETFRVVVTEDADCVEICSTLRNIIAFAAGCSDGMELNENTKAGIIRRGFLEMLQ
FVDVFYPGCRMGTFFEACGISDLVTSCYANRNRKLAEAFVKTGKPLCELEHILISGHEPL
GPVTAELVHILLKKKGLVDKFPLFTTVYKICMGDLPLTRLVEALCQASEDIFHPQHTFQL

BLAST