GenomeNet

>dpo:Dpse_GA17259 K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] | (RefSeq) uncharacterized protein (A)
MIMVRRRARPAKETGGGSAAAAVASDGALSMDTAAAVAVAGGNHLLDDQYFASPKRKDCR
LMKASENLKISSDVVALEEEANNKGVKPTKALTDRTIGVPLATRSQTRTIENFFKADAAA
KCGITLNTHHPEPIKEQKTISTTELPLSDELGDEELERVVGDLLYDGHSTASSDSPSYQN
ENEHEEVMQDTFALRETSPVPVLMADFQTHRSGLRDSHSSSHSSSSSGGASATTDNIFLQ
EPVLTLDIDRTPTKASSIKINKSFELASAVFSSPPSVLNACRFNQIVTLNGGGQCEPQPV
VVAQPQPQPQLQLPPHHNGFELDQHDSSSCDSGVACNLTISAESPAAGGGAGAAARRRKP
ATPHRILCPSPIKTLPRGDGGGLIVPGARKTSGIMMKGDLLSPRKSPRKLPTTTAAVAAC
KSRRRLNQPKPQAPYQPQQPQPPPGTQPTNEDVVVIDDDEDDDDQEEDEGEEDEDDVHAL
LKAAEELENLNKIPIANSNKSNNHVKAMLKPAPAKPRAALTKGSKTKTGSKIQPGPLPLA
ATNGNREMTDFFPVRRSVRKTKTAVKEEWLRNLEQAVLEERSEGLQVRNFMGKGRGVVAV
RHFKRNEFVVEYVGDLISISDATDRERRYALDENAGCYMYYFKHKNQQYCIDATVDTGKL
GRLINHSRAGNLMTKVVVIKQRPHLVLLAKDDIAPGEELTYDYGDRSKESLLHHPWLAF

BLAST