GenomeNet

>dpo:Dpse_GA18102 no KO assigned | (RefSeq) uncharacterized protein (A)
MGQGAHGSWPQTRQHLPHDDDDDDGGDYTITISEDRLIPPSRGSREWGACLVGGTTCMHH
LNVDLLQGGAAEGGGGAAATTKMCPKRHWLVNKATAAGKGSRRSLDQIVEVLVALILVNC
LVATATAALITPPHDLDSIEDEDLSGFYRSPHRLEGYQQQQQQLQQRNSQNFKISPKPCS
FGRVEGTCMFVWECIKSEGRHVGMCVDSFMFGSCCTHNYTDNIVLPQTAFSYTRPTKPLT
LRPRPPPPAYKPMISGMTTIERPHGAGTLVIRPSGPHHQGTLARPHPPPYQSKPTTASDL
LSAASMHAGSSSSSNSIWHTSTQQQQQAQAQAQQQHQQNQQNHWQMTTEPSFITRPRPTG
WTKPGIVNLPMSGPRPSKPSKPTKKPIVYERPPPPPPLPPSSTTTSSTTTTIQTQGPTRP
QLSAGTSLATSSAYPTFSTSKATTTTTTTTTTRRTTTPAPTTTTTTRRTTSNTRPYQRPT
TESSSSTTRSSTTTAKTPTTTRAHPSPSSSSGGGIISSSSSSRPTHRPIGGGGGGGEGGH
IETNEITDSSTHDGAAGGATTALGHVKTISAARSECGVPTLARPETRIVGGKSAAFGRWP
WQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLLISQIRIRVGEYDFSHVQEQL
PYIERGVAKKVVHPKYNFFTYEYDLALVKLEQPLEFAPHVSPICLPETESLLIGMNATVT
GWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFLRAGRQEFIPDIFLCAGYETGGQDSCQG
DSGGPLQAKSSDGRFFLAGIISWGIGCAEANLPGVCTRISKFVPWILEHVR

BLAST