GenomeNet

>dpo:Dpse_GA19543 K20677 serine protease Hayan [EC:3.4.21.-] | (RefSeq) uncharacterized protein, isoform A (A)
MSRRQVGLLLAVLFLLDSCGLNTASEEGEECMVKENLPGICRPSSACEPFVDGYIKSGIL
SINDVPSCGLGPREEIICCPTKPCCPNDPSSKGTATAPATPPAPSPAPAPAPAPSPAPPP
VTIPELSRESRLDQGDSFFDFNQILSTPRSVPQPTGKGGRTHDAIRMQPEPFQSIGQWGV
APPSTTTTPRSVPPWGWTDGTPRIVNKPLTIRDPNPRAQQHMQQGNRRPGNNLIHVVNER
LRQQGMTIEPAREVGSLSLLTPVTPVHLVTPVTPTKKVLVDPFAPFRFQAKEQKGYVVPS
DASMFPFRIPETTSTARPPVSATPISRVDVPTESNEGQERPSVVACRRIQSRYGENRLTV
HILEGIPVNPGVYPHMVAIAYSTFGGSPEYRCGGSLISSRFVLTAAHCVNSMENTPIFVR
LGTVNIESPPPQYKDIGLKNIIIHPNYVSSSKYNDIALMELAEEVNFANNSNIYPACLHT
DTKDPPLSSKLFVAGWGTMNLTNRSRSKVLLRAPLDLVPLDKCNQLFSEQPSTIRALKQG
VIDSMMCAADLKELKADACAGDSGGPLILDINVEDGLYSIVGIISAGFGCATKTPGLYTR
VASYLDFIEGIVWPDKVLGAGI

BLAST