GenomeNet

>dpo:Dpse_GA19945 K00693 glycogen synthase [EC:2.4.1.11] | (RefSeq) uncharacterized protein, isoform A (A)
MMRRQMSYRFEDQDASPYGLRMNRRFSRVESGVDLKDYFDRGDIASRENRWNFEVAWEVA
NKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEVCARTEMEEMEFPRGNPLLDAVNSLRS
RGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGF
MIAEFLEEFRNFAVTYSQNHDLNPPRVVAHFHEWQAGVALIVLRTRQVEIATVFTTHATL
LGRYLCAGNTDFYNNMDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEH
LLKRKPDIITPNGLNVKKFSAIHEFQNMHAVAKEKINEFVRGHFYGHMDFDLDKTLYFFI
AGRYEFGNKGADIFIEALARVNAMLKHERPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQ
LRDTINNVQQAVGKRMFDTCVKGRLPEVGDLLEKDDMVKIKRCMYAMQRESMPPVTTHNV
ADDWNDPVLASIRRCHLFNSVNDRVKMVFHPEFLNSSNPLFGIDYEEFVRGCHLGVFPSY
YEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHISDPKSYGIYIVDRRYIGLEDSIQQLS
SFMMDFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKGLQAVYPDYVDELSLYG
SRSNLVFSRPHSEPPSPTSSRHTTPAPSVHGSEDEDSVDEETELKELGIK

BLAST