GenomeNet

>dpo:Dpse_GA20378 K06067 histone deacetylase 1/2 [EC:3.5.1.98] | (RefSeq) Dpse_Rpd3; Rpd3, isoform A (A)
MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAD
EMTKFHSDEYVRFLRSIRPDNMTEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAV
KLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDG
VEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFV
PIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVDFVKKYNLPFLMVGGGG
YTIRNVSRCWTYETSVALAVDIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKI
KNRLFENLRMLPHAPGVQIQAIPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENAYSD
SEDEGEGGRRDNRAYKGQRKRPRLDKDNNSNKASSEVSSEIKDEKEKVDGADGEESTASN
ANSNSNNNSSSNNKSDNDSSAPASGATTGGGSGSGSGSGSGAKAAKENNI

BLAST