GenomeNet

>dpo:Dpse_GA20820 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) uncharacterized protein (A)
MMDVEVRELMQAFVLSDYQVQEVYSRFCAEISKGLKRSTHALANTKCFPTYVQDLPTGDE
MGKYLALDLGGTNFRVLLVSLKGHHDAMVESQIYAVPKDLMVGPGVELFDHIADCLARFV
EKHEMRNSHLPLGFTFSFPCEQKGLKEAILTRWTKGFGCPGVEGEDVGRLLHEAIQRRGD
AEIAVVAILNDTTGTLMSCAHRNADCRIGVIVGTGCNACYVEDVANVDLLHADFKRNQKD
VLVNAEWGAFGESGQLDFVRTEYDREVDDTSINKSEQLFEKMTSGMYLGRLVRLILMRAM
QSKVIFKLSNRREHFATALQKNEDVFETRFISEIESDSFPEFSKTRTIITELFGLEKASV
EDCQKIKYICECVSKRAATLVAIGVSGLINRISDRRVVVGMDGSVYRYHPKFDAYMRNTM
HKLVKSDKEFDIMLSEDGSGRGAALVAAVASKTK

BLAST