GenomeNet

>dpo:Dpse_GA21752 K01895 acetyl-CoA synthetase [EC:6.2.1.1] | (RefSeq) uncharacterized protein (A)
MPAEKSIYDPNPAISQNAYISSFEEYKKFYQESLDNPAEFWSRVAKQFHWETPADQEKFL
QYNFNISKGPIYIKWMEGASTNICYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRK
LLEEVCRFANVLKDHGIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLA
ERMFDCKAKLLITADGAWRGEKALYLKALCDTALEKVEELGHSVEKCIVVSHLKRVTPCQ
DNHVEEEIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTA
GYLLYAATTFKIVFDYKPGDIYWCTADVGWITGHTYVVYGPLANGATSVIFEGTPFFPGN
DRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYY
RYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPILLDECGIEIKGE
GEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADDYLWITGRVDDM
LNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEPFDQKLISDL
KKMVRERIGPFAQPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQ
LFANRPVEAK

BLAST