GenomeNet

>dpo:Dpse_GA22670 K00814 alanine transaminase [EC:2.6.1.2] | (RefSeq) uncharacterized protein, isoform A (A)
MSRLLINKPSAMQRAAATMSGRAAAALPLRQPYPQQQQQSKLTPSVVIRRWKSFIHSVQK
STTAASAEPAAAAAAAASMTTTTATSHRSRIQSEAFGGRHSPFDARRSFSTSTKMPAKCL
QLENINPNFITMEYAVRGPLVIRAGEIEKELEKGAKKPFDQVIRANIGDCHAMGQQPVTF
LRQLLALTFEPRLLDSPDYPEDVKKRARAILANCQGHSVGSYTDSAGLEVVRRQVVDYIE
KRDGGVPSDWQNVYLTGGASPGIKSILSLIHAEVGGKPPGVMVPIPQYPLYSATIAEYGM
DKVDYYLEEDSGWSLSRKELQRSFDEAKKTCNPRALVVINPGNPTGQVLTRDNIVEIIKF
ANDNGLILLADEVYQDNVYDKNSKFYSFKKVAYEMGEPYRSQELVSFLSTSKGFLGECGI
RGGYMEVVNLCPQVKAMLTKSITAALCSTTAGQVAVSALVNPPKPGEPSYDLFQKEKNAT
LAALKERAELVHKTLSSFEGYKVNPVQGAMYVFPQIEIPPKAVEAAKAKGMAPDVFYAFE
LLETSGICIVPGSGFGQKPGTYHFRSTILPQTDKLKLMMEKFRVFHADFMKKYK

BLAST