GenomeNet

>dpp:DICPUDRAFT_146669 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) gadA; hypothetical protein (A)
MSLHSIKSENTKEKKGNSNKYKRCYDLYAEKSATHPINKYKINDHPTDPDLSKNLILDEL
LLDGNAKQNLATFCQTDVDINIHTLMDKCIDKNMIDKDEYPQTAEIESRCVHMIADLWNS
PDSANTIGCSTTGSSEAAMLGGLALKWKWREQRKKEGKPCDRPNLITGPVQICWHKFVLY
FDIELREIPMENGRLLMSPEEVLKRCDENTIGVVPTLGVTFTLQYENVRAISDALDKYHK
ETGLDIPIHVDAASGGFVAPFITPDLVWDFRLPRVKSINASGHKYGLSPLGVGWVIWRGK
EDIHKDLIFNVNYLGGNMPTFSLNFSRPGGQIVSQYYNFIRHGREGYRAIHQACIDHGVY
IGEEIKKMGIFDLIYDGKGALPGVCWLLKKDAKVKFNLFDLSDRMKTRGWQIASYTLPKN
AESMIITRVLIRHGFSRDMASLLIDDIKRCLEYFEKHPLVKPLSKEEGEGFHH

BLAST