GenomeNet

>dpp:DICPUDRAFT_27300 K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] | (RefSeq) hypothetical protein (A)
KGWGLISCENINKGDFVMEYCGEVISKTTCLNRMQENENEKFFYFLTLNSKECLDASRRG
NLARFINHSCDPNCETQKWIVGGEVKIGIFSIKPIEKGTELTFDYNYERFGASKQECYCG
SKNCRGFLGQKAKTPITNTRKQKTPIRFKTL

BLAST