GenomeNet

>dpp:DICPUDRAFT_49097 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) calmodulin-binding protein ThyB (A)
MAIIPTVVGKIQVIFGPMFSGKTTELIRRIKRFNFANKKCLLIKYSKDTRYNDNIDKSFL
VTHDKQNYQAFPCSILEDIREQAEKYDVIGIDEGQFFPDVVQFSEELANQGKTVIIAALD
GTFQRKPFASVIDLVSKAEVITKLTAVCMVCYNDAAFSKRIVDDDNIELIGGIDKYISVC
RGCYHKDTSMKTLKSVRNVHDKALSGAVVAAHDQFYQDGPQNMAVDDIHLNNDY

BLAST