GenomeNet

>dpp:DICPUDRAFT_49097 calmodulin-binding protein ThyB; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAIIPTVVGKIQVIFGPMFSGKTTELIRRIKRFNFANKKCLLIKYSKDTRYNDNIDKSFL
VTHDKQNYQAFPCSILEDIREQAEKYDVIGIDEGQFFPDVVQFSEELANQGKTVIIAALD
GTFQRKPFASVIDLVSKAEVITKLTAVCMVCYNDAAFSKRIVDDDNIELIGGIDKYISVC
RGCYHKDTSMKTLKSVRNVHDKALSGAVVAAHDQFYQDGPQNMAVDDIHLNNDY

BLAST