GenomeNet

>dpp:DICPUDRAFT_81260 hypothetical protein; K10776 DNA ligase 3 [EC:6.5.1.1] (A)
MSEDKSGSLYSLSKLCEKLKEESTHSGKTQIISSFCKVFNGDLYLLAKLLLCKEDKRVFR
MRDKVMLKICAHIWDADLDDMIADLDNGDFTETCKKFYIEYGKYPEKSTLTLKQVDDFLD
SLTLSGKFDEQVKIISSLLKKCTPQDFRLICRIIDSDLKINTGAKFFLDALHPNAYDAYK
KANNLHGVIEKIQKHSFESDEESDDERSSSSSSNKKKSKKSIDSDDSDNEKSSSKKKSKS
KSKSFDVAIKLMTPIKPMLPKAVKDVDDVAKSSSCFYSEIKYDGERIQIHKDGNKFSCFS
RNLKPLMPWKVDEVKQYIPKATKANQMILDGEVLLMDTKTGIPLPFGTLGAHKKKGFIDA
TVCVFLFDILYLDGKSLIHLPLEERREILEKNVTVVKHRVEFSEVTIVKGIQEKYKLTNL
LNRAFKEKLEGLVIKNADSIYEPGARHWIKVKKDYIKGMADSADLIAIGGYYGSGSFGGL
VTVFLMACYDKVSKRYKTVVKASGGLDDKTIDKLQPKIKETMKKISKDHTKVPDWIDINK
PYTPDFIVEHPRDAMILEIESAELTKTNYHTSGYSMRFPRIVRFREDKDYKTATNLQELM
ELGKDAKIIPTDDIEGEFDDENLIAKRNKKKSLSITATTSTTTTTTTSSKSKDKDQQQSD
NEEEDSKTKDKLFYVGGDLTQPFSGSGDTSPNIFVLNYVDNTDKWNNKGISGAISKRFPK
VVESFEKIKSGESKSEKVLEENIDKEKKKIFVCNLSCIVPPKSKDESYSFSLKHFKSAIK
ESKGVIKNKNGSVHIAKPSFSKPSWSEIEEVLIDELYDSGIKVFVHSIKSPPSVSKTSTL
SSKTTTIDVSVNNNNNNNKNENENEKTSLKRDRDQMLEHEILKELEEKELEAPVFGNVNV
VFDQSVLDNQKLAKKCERLIKILGGRVSEKWCAIKGLDKTTHLICDDGESDLYHHVSRLG
GAIAKTQWVEDCFNNDLLLPIDEIYCYVSKNGSSTSQNHSSKSLDTNTTKNSNAMQIDKL
GESTSTSKKEEKQCKSSPSPTKKQHLLNIFSDCSIYLHENVNDRDTLKRYIVAFGGDVVD
QINEKTTHLIASLPPNFSTVKPKDLFKQFLQQNKTHNKKIGNSLWLWDSINMGEVLDIKS
YKLF

BLAST