GenomeNet

>dpp:DICPUDRAFT_82355 K04097 prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18] | (RefSeq) hypothetical protein (A)
MSVPKVYYYPVRGRGQFVVALLHYLKVDFEIDTTSNEQIKPETTFGQVPYYVDDEIKLAQ
THAIARYLANKHKIHGKSLVEQAKVDEIVDSVWDTLNPLLAATFGGNDSAKEEYKKNNKL
HLFLDVYEKKLNENKYIAGGDDYTLADFDAFLVYNYIDLLGYLTDRNSYPKLEELRKYFT
SLPQLQKYFESVKNTPL

BLAST