GenomeNet

>dre:100000684 K12357 sialidase-2/3/4 [EC:3.2.1.18] | (RefSeq) neu3.5; uncharacterized protein LOC100000684 (A)
MMGCCCLSRHPSSYSAPPEISILFKQELPQCKKQVTYRIPALIYISDKQTFLAFAERRKT
PSDTDAELLVMRKGLWKNDNNPVKWVSGQQVFTSACLPNYRSMNPCPVYERKSKTLFLFF
ICVPVGVSEQQQKNEKKNQARLCYITSKDTGETWSAVTDLTADVIGEQVKNWATFAVGPG
HGIQMKSGRLIIPAYTYYFTSESPPTSHALAIYSDDKGSTWHIGKCMNGLPSNECQMAEI
IDDEGNSKLYCNARSTIHYRVQALSESKGTDFDTSSSVNKLIETGNGCQGSVLSFTPDQA
SEKTWLLYCHPTNATNRLTLGIYLNKCASDLSGWGNPVILHEGPSGYSDLTQCGDGKHFA
CLMECGEKSELEGIGFILFEQKDDKAEKLQITKFTKQN

BLAST