GenomeNet

>dre:100537847 thymidine kinase, cytosolic-like; K00857 thymidine kinase [EC:2.7.1.21] (A)
MDCLNVARILPNSPRKTRGQIQVIFGPMFSGKSTELMRRVRRFQVAQYSCLLIKYAKDTR
YSCTGMATHDMNTMEAVPANRLRDVAPLALQACVIGIDEGQFFPDTVEFCEEMANMGKTI
IVAALDGTFQRKAFGNILNLVPLAESVVKLNAVCMQCFKEAAYTKRLGAEKEVEVIGGSD
KYHAVCRCCYGGLMKENRSPQREETPPHASAAKTLEYSTATRKLFTALHL

BLAST