GenomeNet

>dre:321224 hkdc1, cb370, sb:cb370; hexokinase domain containing 1 (EC:2.7.1.1); K00844 hexokinase [EC:2.7.1.1] (A)
MFAVHLLSFYFSKLQEDQIKKVDRFLYAMRLSEDQLKDISARFRLEMEKGLSSESNAAAA
VKMLPTHVYSTPDGSEKGEFLALDLGGSKFKVLQVKVSEDGKGKVEMESETFPIPEEIVN
GRGTELFEHVAESLKSFLQKHHINHTRKPLGFTFSFPCAQSKIDEGVLLSWSKNFKVRGV
QGTNVVQSLRKAIRKVGDLDVDVLAMVNDTVGAMMTCGYDDQNCEVGVIVGTGTNACYME
EMRHIDLVEGDEGRMCINTELGAFGDDGVLDDFITSFDREIDAASINPGKQLFEKMVSGM
YMGELVRLILLRMAKKGLLFRGQISDALRTKGTFHTNHMCLIEQYKSGLENTKEILEDLG
LNPSDDDCIAVQHVCTIVSFRSANLVAAALAAILTRIRENKKLKTLRTTVGVDGTVYRTH
PQYPKRLHKVVRHLVPDCHVRFVLSESGSAKGAAMVTAVAQRLASQRKEIDDTLAAFALT
STQLQEVKQKMHVELERGLKKETHPTASVKMLPTYVYRTPDGTERGKYLALDLGGTNFRV
LVVKIRTGMRNSVRMYNKIYAIPLEIMQGTGEELFDHIVQCISDFLDYMGMKNTRLPLGF
TFSFPCNQTGIDKGDLVCWTKGFKATDCEGYDVVDMLREAIKRRNEFDLDIVAIVNDTVG
TMMTCAYEDPKCQIGLIAGTGSNVCYMEEMKNIEIVEGDEGQMCVNTEWGGFGENDNIED
IRTRYDREVDSGSLNAGKQRFEKMTSGMYLGEIVRQILIDLTKRGFLFRGRITERLKTKG
IFETKFLSQIESDRLALLQVRCILQSLGLDSTCDDSIIVKEVCGAVSRRAAQLCGAGMAA
IVDKIRENRGLDRLDITVGVDGTLYKLHPHFSTILKETVRELAPNCKVDFILSEDGSGKG
AALITAVARQHHVQKQEQN

BLAST