GenomeNet

>dre:321892 ckmt1, fb37h03, fb69a12, wu:fb37h03, wu:fb69a12; creatine kinase, mitochondrial 1 (EC:2.7.3.2); K00933 creatine kinase [EC:2.7.3.2] (A)
MASSFARILSGNRKVGILSLVGAGSLTVGFFLNREQHVSAGSSVRRIYPPSAEYPDLRKH
NNCMASHLTPAVYAKLCDKSTPNGYTLDEAIQTGVDNPGHPFIKTVGMVAGDEESYEVFA
DIFNPVIKERHNGYDPCNMKHPTDLDSSKIRGGMFDEKYVLSSRVRTGRSIRGLSLPPAC
TRAERREVERVVVDALAGLKGDLTGKYYSLTVMTEQEQQQLIDDHFLFDKPVSPLLTCAG
MARDWPDARGIWHNNEKTFLVWINEEDHTRVISMEKGGNMRRVFERFCKGLQEVERLIQE
KGWEFMWNERLGYILTCPSNLGTGLRAGVHVNLPRLSKDPRFSKILDNLRLQKRGTGGVD
TAAVGSTFDISNLDRLGQSEVQLVQTVIDGVNYLIECERKLEKGQDIKIPAPISQFK

BLAST