GenomeNet

>dre:321892 K00933 creatine kinase [EC:2.7.3.2] | (RefSeq) ckmt1; creatine kinase U-type, mitochondrial (A)
MASSFARILSGNRKVGILSLVGAGSLTVGFFLNREQHVSAGSSVRRIYPPSAEYPDLRKH
NNCMASHLTPAVYAKLCDKSTPNGYTLDEAIQTGVDNPGHPFIKTVGMVAGDEESYEVFA
DIFNPVIKERHNGYDPCNMKHPTDLDSSKIRGGMFDEKYVLSSRVRTGRSIRGLSLPPAC
TRAERREVERVVVDALAGLKGDLTGKYYSLTVMTEQEQQQLIDDHFLFDKPVSPLLTCAG
MARDWPDARGIWHNNEKTFLVWINEEDHTRVISMEKGGNMRRVFERFCKGLQEVERLIQE
KGWEFMWNERLGYILTCPSNLGTGLRAGVHVNLPRLSKDPRFSKILDNLRLQKRGTGGVD
TAAVGSTFDISNLDRLGQSEVQLVQTVIDGVNYLIECERKLEKGQDIKIPAPISQFK

BLAST