GenomeNet

>dre:323856 K05625 transglutaminase 2 [EC:2.3.2.13] | (RefSeq) tgm2b; protein-glutamine gamma-glutamyltransferase 2 (A)
MALDIGSWDLACKFNNTDHHTELNGTDRLIVRRGQAFTINLQLNSGSYQPGYSQINITAE
TGPDPQQQYGTRAVFSLSSEVDSSCWSAAVSSPPGESVCLSICAAPDAPIGHYTLTLDER
IQIQFILLFNPWCPLDVVYMDNEEKLAEYVLAQDGIIFRGDAGYPVPLAWNFGQFEEGIL
DACFRILDMNPKHRRNPAKDCSGRRNVIYVTRVLSAMINSNDQDSGVLEGCWRDTFDGGV
SPMSWGGSVQILRTWDRSSCLPVRYGQCWVFAAVACTVARAVGIPCRVVTNYYSAHDTNS
NLLIERYVNEKGEVDHSSTRDMIWNYHCWVESWMGRSDLPPGFDGWQASDPTPQEKSEGV
FCCGPVPVRAIKEGELTFKYDAPFVFAEVNADLVYFLKSKDGSTRKINYDQKVGQKISTK
SVGRDEREDITHLYKYPEGSADERRVFEKANHQNKLLQEKQNTGLNITIKLSSGVRKGCD
FDVFAIVTNGTAEEKKCRLVFASRAVSYNGVIGRECGFKDLLNVELPPGGERKVPLRLNY
SKYCNNLTEDNLIRLGALLIDYSTRDAIMAMRDIVLDDPEIKIRILGEPKENRKLAAELT
IQNPLPEALQSCCFTIEGANLTGGDSITHTLDSSIEPGQEAKAKIYFTPTQSGLRKLLVD
FNSDKLGHVRGYRNVIIGK

BLAST