GenomeNet

>dre:447909 K05625 transglutaminase 2 [EC:2.3.2.13] | (RefSeq) tgm2a; protein-glutamine gamma-glutamyltransferase 2 (A)
MERVVEIGSIDLACEVNNTNHHTHLNGVDRLIVRRGQTFTIHLHLKEGTHFQNGDNIKFI
AQTGPIPSVEAQTKARFSLSKVISRLSWSATAETHNSTVSLSICAHTNAPVGRYTLILDQ
GDGVILGEFVLLFNPWGKLDSVYLANEAEREEYVLSQDGLIYRGTPKRITVLPWTFGQFE
HGILDICLQILDESPNYISDAALDCSERKNAVYVTRVLSAMINSLGDKGVVVGNWSDDYE
DGVKPTVWKDSCSILRQWSNEGCRAVRYGQCWVFAAVACTVSRALGIPCRVITNFGSARD
SNGDLIMERFYNEFDENIADDSIWNYHVWVENWMTRPDLALGYEGWQASDPTPQHRSDGV
FCCGPASVRAIKEGELTFKFDVPFVYAEVNADVVEYIKLRDGRVFKMGGSTTEIGKSIST
KAVGRDEREDITHNYKYPEGSEEERKVFKKANHHNKLAQAGEEPGLHIKIRVTPDMQIGS
DFDVYAEIKNNTMVTKSCRVMFYAQAVSYNGTLGETCGLGDFTEMSLASSDGGKVTLRLE
YAEYSKAITQDRMIKLVGLLIDAETREFYRAKKTIVLDAPEIIVNILGVPKVGRNLVADL
ALQNPLPEPLENCVFTIHGANLTDGKPITHEVGTIGPKEFATAKVEFAPKLPGQRKLIID
FASDKLHNIETYENLVIYE

BLAST