GenomeNet

>dre:449663 K00006 glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8] | (RefSeq) gpd1l; glycerol-3-phosphate dehydrogenase 1-like protein (A)
MAAPLKVCIVGSGNWGSAIARIIGSNAQKLQCFATTVKMWVYEEMVNGKKLSEIINTEHE
NVKYLPGYKLPENVVAVPQLRDAADGADLLVFVVPHQFIRKLCDEMMGCVSERARGITLI
KGIDEGPEGLKLISDIIREKMGIDVSVLMGANIANEVAAEKFCESTIGSKVLENGLLFKD
LLQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLQCGDNTKAAVIRLGLMEMIAFA
KLFSKDDSVSSATFLESCGVADLITTCYGGRNRRVAEAFAKTGKSIEELEKEMLNGQKLQ
GPLTSAEVYHILKQKGLVEKFPLFTAVYQICFEDKPVRDMITCLQSHPEHL

BLAST