GenomeNet

>dre:556086 nsd1a; nuclear receptor binding SET domain protein 1a; K15588 histone-lysine N-methyltransferase NSD1 [EC:2.1.1.43] (A)
MNQSYKVAGRDGSECRGDPQDSRALDVRIGSCGQQSTKADQSSAMHFLNPGYKLSAPFAY
NQRESTSNYSPLRRLQDLTTMVNHADGGLQDKDFHGRNKLLMHSPIGGNEFGIGLYNTTN
SQGNTAIQDLDKNGFSPVSSDSLEHFSPISNGFLHFDSTLFDSGDSKDNDEDVKGEVATF
KDTSKKCQKRNVAKTETQSSHRLDANKHSSKNTAKSDPPASPFHVPFTMMEDFDSMDDYS
DSDCDLPSTENCASIFNLSKRAHSPSDSHSNPSSSPKKKQLLSVKYSIGDVVWAKFNRRP
WWPCHVTTDPQIDVHTKMKDPSRRPCRLYFVRMFGEIVDQAWVPAKATFPFEGGDQFEKL
PVLRRRGRQKEKDYKYTVPKRLIPSWKASVLEAEASLTKQLNSEPPLTLIQDVCVPITED
KAHKKNPACPKSTTLSTPSSSLLSNGLNASVKNRLKPGTASKKKATKKMIQSQSIKLSET
PSLFKSKSNPSSDKPSIATDPLDSPYSDIDSVPRILCSKRIDESLQVELEKELSTKTTKV
QACKKTSKNSVDKPGKKTDVKCLKNSKLKKSTPKDKTLKATSSRLKESSSPGSSDGSFAM
HSHYLPASSGLIVRALAAGEETKEKDLSHEPNSHSPSSEHSSQTNHELSKQNWEVKNNSE
SSEESVDASDSPPNPTSIKRIKKRPQKNGIHKDPPPKSHEESESKVNNESMFSDTSSSSI
PSPSISPMDAFQDIKELSFRSLVKEECSSGESPLRADSNYKFSTFLMLLKDLHDSREKEG
KPLTLPPTSPSSLIKEEPSLIPVGEEPPNEVLCEKEFAEQSSLPGKTSTPNNSKQSKAKL
KSTVKKESQKPDVVIDSVSPLKKPISPVGLDVLDKSLPLLGDLPKSSDVSAAVTDVCAKG
TISKVAPKKRWKTFESELGKSIKPKSDQVDSTLDEVKSVSTEPNGVFKDGLQESAHSDVP
NKKDASENKRLRKPSKRLIECGEEYEQIFPSKKKTKKSTESCKTGSCISNTTPEQPASDQ
ITLDAVSSSSAEKPLDHVVAEEQKPPADVLVPPSAPKSPSCATSLETEPCEKKSAPLERK
RPRKSVHKVLDCAIEGESVKIPKKGESRQHKTNPEESGVRDLEKQEEAGPPPSSPCAVSA
QSEGELRTSSPIQPDVPSVSQIPVEGEQSSPSKPQINNEDSLISEGFAAGLNDSAFSSRD
SLSGDLSGLSTNKRSVERGGGASLKENVCQVCEKTGELLLCEGQCCGAFHLQCIGLTETP
KGRFICQECKMGVHTCFVCKKPDKEVRRCMIPVCGKFYHMDCILKYSPTVAQNRGFRCSI
HVCLSCYITNPNNPGISKGRLTRCVRCPVAYHANDYCMAAGSVPLANNSFLCPNHFTPRK
GCKNHEHINVSWCFVCSEGGSLLCCESCPAAFHRECLNIEMPQGSWFCNDCRAGKKPHYK
DILWVKVGRYRWWPAEVTQPKSVPENISRMKHEVGEFPVHFFGSKDYVWTYQARCFPYME
GDANNKEKMGKGADAVYKKALNEAADRFRELLKEKEMRQLQEDRKNDKKPPPYKHIKVNK
QIGKVLIITADLSEIPRCNCKATDENPCGIDSECINRMLLYECHSQVCPAGERCQNQSFT
KRQYTEVEIFRTLSRGWGLRSISDIKKGAFVNEYVGEVIDEEECRSRIKNAQDNDICNFY
MLTLDKDRIIDAGPKGNESRFMNHSCQPNCETQKWTVNGDTRVGLFALEDIPKGVELTFN
YNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPPSDDKTRKLRRKVSGKRKSQSEVTKERE
DECFYCGDGGQIVSCKKPGCPKVYHADCLNLSKRPAGRWECPWHQCNECGREAASYCEMC
PNSYCEQHREGMLFISKLDGKLSCSEHDPCGPDPLEPGEIREYVPSTSIVGQAPNMSASG
RITQPALPPAAPLFIPAQNRPAFQSQRDPYGDEVVDNILPSSSPKDIKEEDMSDGEVVFE
EGEEEEEDLELVDDEDDEEEIDCRGMGLEDEEEEEEFEDYEDDFVNVDFVGTEDGDEVEG
DEQETSWDELVEAEK

BLAST