GenomeNet

>dre:559012 K05625 transglutaminase 2 [EC:2.3.2.13] | (RefSeq) tgm2l; protein-glutamine gamma-glutamyltransferase 2 (A)
MASYNAILSDVDLQCYENNHAHRTEEMDVERLLVRRGQPFSVVLQCTEQIPQLPDHQINL
ILHLGKNNEVVLKVSDSEQDPGKWWFSQRNAQGEVMLTLHSPADAPVGLYSMTVVLLSAD
GEIQEQTSPQTFYLLFNPWCKDDCVYLPSEEMLQEYILNENGILYQGAWDDITTVPWNFG
QFEKDVVDICFDVLDNSPAALKNSEMDIFNRASPVYVSRTITAMVNANDDRGVVSGRWDG
EYSDGVAPTRWTGSVPILRRWSEDGGQKVRYGQCWVFTGVACTVLRCLGIPTRCITNYSS
AHDTDANIAVDYLVNDQLESVSEGRKDTIWNYHCWVESWMKREDLPEGYDGWQVLDPTPQ
ERSDGIFCCGPCPVRAVKEGEVGLKYDTPFVFSEVNADLIVWIVHPDGDRSEVSQNSKII
GRKISTKSVYGDFREDITANYKYPEGSMKEREVYKKAGRQVGQKKDGPGQLELFIKHAPA
IHGTDFDVIIEVYNAGREDTDAQLTVTSNAITYNSIHRGECQRKTTSLTVPAYKAHKEVL
RLQYDHYGACVSEHHMIRVTALLQPNDQDNLILQETNIPLKMPALHVKIIGNAIVSRKLT
AHISFTNPLPINLQGGVFTVEGAGLTEAREIKTHGKIESGQTVTVKFSFKPTRAGLRKLL
VDFDSDRLRDVKGEASVIVRTRMRHVNAVPEI

BLAST