GenomeNet

>dre:559691 protein-glutamine gamma-glutamyltransferase 2-like; K05622 transglutaminase 5 [EC:2.3.2.13] (A)
MCSSSSSNTPDQGVRVDLECVKNNTDHHTHEITQERLIIRRGQAFSLKISAENIQQNHIS
ITAETGPGVSEVKHTLFSFSTQSSTNPAQVCSRSESSVSLALVFPSDAPVGRYSVCVKHG
SSSCMNTLTLLFNPWCKDDHVYLPSEAERQEYIMSEQGVLYKGVDEYITSMNWDYGQFEE
DIVDICLKLLDLNPKCLKDPQEDYSARCNPVYVSRVVSAMINCNDDQGVLAGQWGDSYTG
GVPPSRWSSSVEILRRWVKYNCSPVKYGQCWVFAAVMCTVLRCLGIPCRVVTNYQSAHDT
DRNLVVDEYFSDYGVRPKNSQDSVWNFHVWVEAWMRRPDLTEDTLYDGWQVLDPTPQEKS
SGTYCCGPAPVMAILEGHTEVKYDVPFVFAEVNADRVCWLLMTDGSRKKIMSDSRSVGQN
LSTKAVGSSSRLDITDLYKHGEGSAQERAVYTEAVHRLTDLQIPESPPVSVQMRLSLDVP
PLNGADVPLKLFLKGSRAQCVCVNISAQVMRYTGAPAAAVWSHSTDVQLQDTEEKALSFT
LPYSAYGHRMLENNCIKVSAIAREKNNPKDTYLTEKNIILHTPNLSITVSGSPLLDSEMT
ATVQFENPLSSTLQNCSISLSGSGLLKSTEKSSTVQLGPGQRIRLQVSFTPYRLGLKKLM
ATFNSATFKDVQASADVDVRSA

BLAST