GenomeNet

>dre:559945 K11427 histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43] | (RefSeq) dot1l; histone-lysine N-methyltransferase, H3 lysine-79 specific isoform X1 (A)
MGEKLELKLKSPVGAEAAGYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNKRPSNGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQIIDEMEMMEEDTFVDLGSGVGQVVLQVAAATNCK
HYYGVEKADIPATYAESMDKEFKRWMKWYGKKHGEYTLERGDFLSEEWKERIASTSVIFV
NNFAFGPEVDHQLKERFANMKEGGKIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLR
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEVARRRPQKDSKENKSNTTTPT
KPKEHKQAQHDSGGEEEPVVPVKPSPKPRRAKILTRGRKLGNRKRGRPKKAPAATAAERK
NKKSQSALDLLHAKTLSAAPAQEPYRSPQSPFYQLPPKVQHYTSSQLLMAPTPPGLQTLL
DNIKVQYLHFMAYMKTPQYRTNLQQSLEQEKLRHTELSSQAQQLVNACHAHKERIHDLFQ
SKLEELGVKAVTVEDLVQAQKEITAHNMQLREQTKQLEHDMAELRDQSQLLLKARCEELK
LDTLCWDTLKKEIEALRRQISEKQRHCLELQISIVELEKSQRQQELLQLKSSYSPCEVSP
YRKALPGPDPRPTLDPDTPKLTPQSSMGLNGLSPELSINGTASPGYERCTGSAMGKNELL
THYLPISPDHEIVPPTPDSRTRQLGQPLPDYTRFSPAKIALRRHLNQDSAANQFRALGNI
HRGDTGAISSPTLGFKQASPCSSEVQAVTTAKSTDRADKEKSPTAPGDTITSLPISIPLS
TVHPSKLPVSIPLASVVLPNRVERLRSTLSPVLNPAGQSNGKPPLTPTSGYSSSSGLVNG
SHSTMLTEDQDCDVASPPPHSTPVMGLQPRGSGLSPPLGTGGVLQYADGPPRLPPEDGHE
RQGPESDTEPLDSEARRRIFFSSSSSSSSSSSSTGGSRLHHGSVKQGHHHHSKHHHHHHH
HHHHHSPSSHSQEGRKRGRRKRSSSGAVPMSGSPKRRVFPGLGCSSHSSGSPLNINSMVN
NINQPLEISAISSPEQSGRSPCEQDLDQPPVLKRERPLELNNTGRYSSAPSSDEEGNGYA
PDTSSSSRIERKIATISLDRDGPVRDLERGLQGRKSGASSVSSEVSSSSGTSKWKSTFSP
ISDPKPTPPDIRQGGSPFSVGASRGGTDSDSDHKPQRRGEREREPYGNSNLFLSQDGSGR
SAVNTSERSLQKQKVREWDLKSVSGLASQNLFISAAASGGILSGKVGGAATVSSASAVGQ
YFPLGGASVLQPLFGTQAAGPATSGAPRLVNGHSALGSFSSAGLAGGAAGGIFHHMVSSS
SSQQSGPNLPSSHNSQQRHLDTNPKAGASFLASGPNRTQTVLHAPSPPTLALPPPPPLLN
TVPSQPSSPRSSRPQSSIPVATSSQSLAAASSSCTSSASSRPFTVHYPPHLQPPGSAGSG
GTGASWRTLASYTASQIPGNRPR

BLAST