GenomeNet

>dre:561287 K03917 coagulation factor XIII A1 polypeptide [EC:2.3.2.13] | (RefSeq) f13a1b; coagulation factor XIII A chain (A)
MADQVAPENPTPAAAPTVRPKQRVSHRGRSAGGRASSNQQEGKVEEFEPFMLMPRGPPPL
TEYLDIFDVDVLKQPNEVNKQAHHTHLYSSNFLIVRRAQEFQIKITFNRPYKPAEDKFAV
EFVIGPVPQYSKGTYIPVFPTAKRQSVWSGRVIESSENVVTMGITPSAECIVGKYMTYIG
VETPYGIRRTRRDPNTDIYILFNPWSPADPVFLDDEEEREECVMNELGIIYHGAYDDVSE
RAWNYGQFEFGVLDACLFVMDKADMPLSNRGDVVKVTRVASAMLNSRDDDGVLVGNWSGD
YMYGVPPTSWTGSVEILLDHANSSGTPVCYAQCWVYAAVFNTFLRCLGIPSRVVTNFFSA
HDNDGNLKMDIILDENGKLDRNRTKDSIWNYHCWNECYMARPDLPSGFGGWQVVDATPQE
TSDGMFRCGPASVAAIKHGQICYPFDAPFVFAEVNSDVVFYRRRKDGILEVVKVNQTHVG
RMVLTKAVLHSGRRDITNQYKFPEGSPEERRVLEKAEEFGCQREKSSPALSDVDVEIHSL
DVNVGENFDVTLQFTNRSDQRRTADVYITGTVVYYTGVPSGEVVFKTPKVKLEPMQSKEE
KVLVRSEDYMNKLVEQRNIHFIATGKIKETGQIITAMKVIAMHHPKLTVKVTGSPRVSEE
MYVSVEFTNPFKFSLENVDLRVEGPGVLPFKYKQYSVIAPGTSITWTEAFSPRRAGSTKV
FAKLDCAALRQVYGETELTVQE

BLAST