GenomeNet

>dre:561287 f13a1b, f13a1, wu:fo83d04, zgc:153334; coagulation factor XIII, A1 polypeptide b (EC:2.3.2.13); K03917 coagulation factor XIII A1 polypeptide [EC:2.3.2.13] (A)
MADQVAPENPTPAAAPTVRPKQRVSHRGRSAGGRASSNQQEGKVEEFEPFMLMPRGPPPL
TEYLDIFDVDVLKQPNEVNKQAHHTHLYSSNFLIVRRAQEFQIKITFNRPYKPAEDKFAV
EFVIGPVPQYSKGTYIPVFPTAKRQSVWSGRVIESSENVVTMGITPSAECIVGKYMTYIG
VETPYGIRRTRRDPNTDIYILFNPWSPADPVFLDDEEEREECVMNELGIIYHGAYDDVSE
RAWNYGQFEFGVLDACLFVMDKADMPLSNRGDVVKVTRVASAMLNSRDDDGVLVGNWSGD
YMYGVPPTSWTGSVEILLDHANSSGTPVCYAQCWVYAAVFNTFLRCLGIPSRVVTNFFSA
HDNDGNLKMDIILDENGKLDRNRTKDSIWNYHCWNECYMARPDLPSGFGGWQVVDATPQE
TSDGMFRCGPASVAAIKHGQICYPFDAPFVFAEVNSDVVFYRRRKDGILEVVKVNQTHVG
RMVLTKAVLHSGRRDITNQYKFPEGSPEERRVLEKAEEFGCQREKSSPALSDVDVEIHSL
DVNVGENFDVTLQFTNRSDQRRTADVYITGTVVYYTGVPSGEVVFKTPKVKLEPMQSKEE
KVLVRSEDYMNKLVEQRNIHFIATGKIKETGQIITAMKVIAMHHPKLTVKVTGSPRVSEE
MYVSVEFTNPFKFSLENVDLRVEGPGVLPFKYKQYSVIAPGTSITWTEAFSPRRAGSTKV
FAKLDCAALRQVYGETELTVQE

BLAST