GenomeNet

>dre:562705 K15423 serine/threonine-protein phosphatase 4 catalytic subunit [EC:3.1.3.16] | (RefSeq) ppp4cb, PP4C-B, zgc:172126; protein phosphatase 4, catalytic subunit b (A)
MGDMSDLDRQIDQLRRCELIKENEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFY
DLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQI
TQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTI
DRKQEVPHDGPMCDLLWSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQL
VMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKEFIIFEAAPQETRGIPSKK
PVADYFL

BLAST