GenomeNet

>dre:564592 nsd1b; nuclear receptor binding SET domain protein 1b (A)
MDAGLSDICTSPPSPDFSLDSSSPFANGLHFESILFEDEEEDEVMDPEPVSQPERNLCGS
TSDCTTNTNLKTNLDGKSRRKNSKAHSSLEQDVVFQDKAKSDSGLSTLVSRPGGVLMKQK
KKSKTKALPPVKYLEGEVIWAKFNRRPWWPCQVIIHPLEGVYHKMKEPPDRTTRQYFLKT
FGEPEEQAWVPERSTHIFVGGYQFNNLPFVKGSGHQRDENTRHSIPKRFLNSWSASVVAA
EALLLEKPRVTSPSSAFKTISEETINNTEIKVSVPVDLPNSSFLINGAVIQNNHLNSLPH
NRKSKNKKKPTISHCRISEELNCEKGMIMDALDSPYSDIDSVPQIRRFPKSNEQISNHYV
INYKQSSATPTVLPSTNDKDVKKNVENQGGLWFSKTGKGQVNGISRAGIKSVNCSFGKVS
CKIKMPDSASMKPKDNHNTGLEHLSTEAKKALDRRVKCLPASSRLMTRALKAMEDAEWTK
ESSSDLETKNCVSSFDSPSLETSDVHNSILLQKMPTAAIHDLKEDSKISTHAKLSSELLC
CKDDEHSVKSEDESSLVSQAPCAFHSSTRKQNSHVNDLSSSPTPSLHLNLKDMDNMNEIS
FKSLANEHSGQPLSFHPDSNYKFSTFLMMLKDMHDSREKDGNVLVVEPLPTTELINEEPL
LISDVKDEKATSKQKKVKPKTNVMSENHLASTISKTAQRSSKKISLKKKTTDIKANIDYK
SFDKLISAHRLTSKEAETNFSANVPKKRWQKFDQVSEKTVHIVEGNCIHKTERVSSENCD
VSMDGTNKSCFFGPETTSNALECNQGNCQNTEAPTECKRIRKPSKRLIEWTEEYDQLFSA
KKKAKKKPDSVTKIENQKCSEPVAKTYDEVKQKPQVTEQDVSRRLPELQTPPPEDQSQST
PLINTLPCQESQVLSAETLTPPPEIIPSPCDNISNRDQLQRQNPVAVGDSVCLNSKRQRK
PTKKILESSIEAEPILIPKRKMKSMKICSSGHSTNSGVEQQSSKSKNKLSIESSDPPSDP
MLKSTEMEIDVSPAVLQTINTESADDGSDTLRCSGSQMTESSEFYSEREENSQSDKVLLD
SRRLSEEKGGSTSVKENVCPMCEKQGDLLLCEGQCCGAFHPQCTGLNEPPTGKFLCQECT
SGVHSCFACKRLGEDVRRCMVPGCGKFYHGECAASHAPTVPLNRAFRCPLHACLSCFILN
PANPSVAKGQLTRCIRCPVAYHSSDFCIPAGSVTLTDSNIVCPNHFTPRKGCRNHEHVNV
SWCFVCSEGGSLLCCESCPAAFHRECLNIDMPEGSWYCNDCRAGKKPHYKEVVWVKVGRY
RWWPAEVSNPKDIPENILRMKHDVGEFPVLFFGSNDYLWTYQARVFPYMEGDANSKEKMG
KGVDSTYKKALDEAALRFKELQAEKELRQLQEDRRNDKKPPPYKQIKVNKPFGKVLIISA
DLSEIPRCNCKATDENPCGMDSECINRMLLYECHPQVCPAGERCQNQCFIKRQYCQVETF
RTLSRGWGLRCVHDIKKGGFISEYVGEVIDEEECRARIKHAQENNIGNFYMLTLDKDRII
DAGPKGNEARFMNHCCQPNCETQKWTVNGDTRVGLFSLTDIPAGTELTFNYNLECLGNGK
TVCKCGASNCSGFLGVRPKNNPPSDDKGRKLKKKRKSQQEVIKEREDECFSCGDGGQIVS
CKRPGCPKVYHADCLNLTKRPAGRWECPWHQCDLCGQEAASFCEMCPSSYCVEHRDGMLF
ISKLDGRLSCSEHDPCGPEPLEPGEIREYPGELRPTYPINIIKSAKNKSHILNTPKAVPQ
APSPLDVAPQVSPSPSCSPPPLTIFLNGPYSPNSSYEEKKEEEESVTLLEKDGEKSVPRD
KSERLRIKKKTEV

BLAST