GenomeNet

>dre:564592 no KO assigned | (RefSeq) nsd1b; histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific isoform X1 (A)
MDAGLSDICTSPPSPDFSLDSSSPFANGLHFESILFEDEEEDEVMDPEPVSQPERNLCGS
TSDCTTNTNLKTNLDGKSRRKNSKAHSSLEQDVVFQDKAKSDSGLSTLVSRPGGVLMKQK
KKSKTKALPPVKYLEGEVIWAKFNRRPWWPCQVIIHPLEGVYHKMKEPPDRTTRQYFLKT
FGEPEEQAWVPERSTHIFVGGYQFNNLPFVKGSGHQRDENTRHSIPKRFLNSWSASVVAA
EALLLEKPRVTSPSSAFKTISEETINNTEIKVSVPVDLPNSSFLINGAVIQNNHLNSLPH
NRKSKNKKKPTISHCRISEELNCEKGMIMDALDSPYSDIDSVPQIRRFPKSNEQISNHYV
INYKQSSATPTVLPSTNDKDVKKNVENQGGLWFSKTGKGQVNGISRAGIKSVNCSFGKVS
CKIKMPDSASMKPKDNHNTGLEHLSTEAKKALDRRVKCLPASSRLMTRALKAMEDAEWTK
ESSSDLETKNCVSSFDSPSLETSDVHNSILLQKMPTAAIHDLKEDSKISTHAKLSSELLC
CKDDEHSVKSEDESSLVSQAPCAFHSSTRKQNSHVNDLSSSPTPSLHLNLKDMDNMNEIS
FKSLANEHSGQPLSFHPDSNYKFSTFLMMLKDMHDSREKDGNVLVVEPLPTTELINEEPL
LISDVKDEKATSKQKKVKPKTNVMSENHLASTISKTAQRSSKKISLKKKTTDIKANIDYK
SFDKLISAHRLTSKEAETNFSANVPKKRWQKFDQVSEKTVHIVEGNCIHKTERVSSENCD
VSMDGTNKSCFFGPETTSNALECNQGNCQNTEAPTECKRIRKPSKRLIEWTEEYDQLFSA
KKKAKKKPDSVTKIENQKCSEPVAKTYDEVKQKPQVTEQDVSRRLPELQTPPPEDQSQST
PLINTLPCQESQVLSAETLTPPPEIIPSPCDNISNRDQLQRQNPVAVGDSVCLNSKRQRK
PTKKILESSIEAEPILIPKRKMKSMKICSSGHSTNSGVEQQSSKSKNKLSIESSDPPSDP
MLKSTEMEIDVSPAVLQTINTESADDGSDTLRCSGSQMTESSEFYSEREENSQSDKVLLD
SRRLSEEKGGSTSVKENVCPMCEKQGDLLLCEGQCCGAFHPQCTGLNEPPTGKFLCQECT
SGVHSCFACKRLGEDVRRCMVPGCGKFYHGECAASHAPTVPLNRAFRCPLHACLSCFILN
PANPSVAKGQLTRCIRCPVAYHSSDFCIPAGSVTLTDSNIVCPNHFTPRKGCRNHEHVNV
SWCFVCSEGGSLLCCESCPAAFHRECLNIDMPEGSWYCNDCRAGKKPHYKEVVWVKVGRY
RWWPAEVSNPKDIPENILRMKHDVGEFPVLFFGSNDYLWTYQARVFPYMEGDANSKEKMG
KGVDSTYKKALDEAALRFKELQAEKELRQLQEDRRNDKKPPPYKQIKVNKPFGKVLIISA
DLSEIPRCNCKATDENPCGMDSECINRMLLYECHPQVCPAGERCQNQCFIKRQYCQVETF
RTLSRGWGLRCVHDIKKGGFISEYVGEVIDEEECRARIKHAQENNIGNFYMLTLDKDRII
DAGPKGNEARFMNHCCQPNCETQKWTVNGDTRVGLFSLTDIPAGTELTFNYNLECLGNGK
TVCKCGASNCSGFLGVRPKNNPPSDDKGRKLKKKRKSQQEVIKEREDECFSCGDGGQIVS
CKRPGCPKVYHADCLNLTKRPAGRWECPWHQCDLCGQEAASFCEMCPSSYCVEHRDGMLF
ISKLDGRLSCSEHDPCGPEPLEPGEIREYPGELRPTYPINIIKSAKNKSHILNTPKAVPQ
APSPLDVAPQVSPSPSCSPPPLTIFLNGPYSPNSSYEEKKEEEESVTLLEKDGEKSVPRD
KSERLRIKKKTEV

BLAST