GenomeNet

>dre:565980 ace, fb81h03, si:ch211-124e16.1, wu:fb81h03; angiotensin I converting enzyme (peptidyl-dipeptidase A) 1; K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MNRGKRESRTPIGKQEHPAVNVSRRLLRKLLSQHSASQLRSIMLRAVVLLTLISWSAALK
PEWMPGDYPPTEQGAERFVSDYNSTAEEVLYLSTEASWNYNTNLTDHNSQLQIEASLEEQ
AFTEAWGHKAKATFSESLMDTFTNPDLKKIIKKINVLEAANLAITDRELYNTILSQMDSI
YSTAKVCPSPEECWSLEPELQEIMATSRSYKRLLYAWEGWHNSSGVPLKSLYAEFVKISN
KASQMDGFKDTGEYWRSWYESPTFKQDLENLFKQLEPLYQNLHAFVRRKLYDYYGPKYIN
LKGPIPAHLLGNMWSQTWNNIYNMMIPFPNRPNVDVTNTMIAKGYNATHMFRVAEEFFTS
LGLLEMPPEFWDKSMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEM
GHVEYYLQYKDQPVSFRRGANPGFHEAIGDVLSLSVSTPKHLHSIDLLDQLTDDAESDIN
YLLKMALEKIAFLPFGYLIDQWRWSVFSGETPPDRYNADWWYLRTKYQGICPPTRRTEEH
FDAGGKYHIPGNTPYIRYFVSFILQFQFHEKLCKEAGHTGPLHKCDIYKSREAGAVLEKV
LKAGSSEPWTQVLQEALGTDKMDATPLMSYFLPVTTWLREQNEKTGETLGWPDFNWVPPI
PEGYPEDIGKITDEMQAKQFLDEYNSTAEEVWNAYTESSWTYNTDITEAHKDNMLQKNLE
MANHTKIYGLEARKYDTSDFQDESVKRILSKLSDLERAALSAEDLVEYNNLLASMETLYS
VATVCKDKSNCLPLDPDLNKIMAESRDYDELLFAWQGWRNASGREIRDSYKRYVELANSA
AKSNGHTDNGAFWRSLYETPTFEQDLEALWKDLEPLYLSVHAYVRRALYKKYGPERINLK
GPIPAHLLGNMWAQTWSGIMDLVNPYPDATQVDATPAMIAQGWTPKRMFEESDRFFTSLG
LLPMPPEFWNKSMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTVVTMDDLITVHHEMGH
VQYFLQYKDQPISFRDGANPGFHEAIGDVLALSVATPKHLQSIGLLDKVEDNAESTINFL
MSIALDKIAFLPFGYLMDQWRWKVFDGRISSSEYNKEWWNLRMKYQGLCPPVPRTEKDFD
PGAKFHIPANVPYIRYFVSFVIQFQFHKGLCDAAGHKGPLHNCDIYQSKEAGKLLSDVMK
MGFSKPWPEAMKIITGQPKMSVQPLMEYFKPLIEWLEKENEKNGDVLGWPEYDWTPYKLV
EESPKSVNFLGLSVDAAGAAAGQWILLVLSIVFLLAVVFLAYRYSKTKRLQNKSMSQMEL
K

BLAST