GenomeNet

>dre:565980 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) ace; angiotensin-converting enzyme (A)
MNRGKRESRTPIGKQEHPAVNVSRRLLRKLLSQHSASQLRSIMLRAVVLLTLISWSAALK
PEWMPGDYPPTEQGAERFVSDYNSTAEEVLYLSTEASWNYNTNLTDHNSQLQIEASLEEQ
AFTEAWGHKAKATFSESLMDTFTNPDLKKIIKKINVLEAANLAITDRELYNTILSQMDSI
YSTAKVCPSPEECWSLEPELQEIMATSRSYKRLLYAWEGWHNSSGVPLKSLYAEFVKISN
KASQMDGFKDTGEYWRSWYESPTFKQDLENLFKQLEPLYQNLHAFVRRKLYDYYGPKYIN
LKGPIPAHLLGNMWSQTWNNIYNMMIPFPNRPNVDVTNTMIAKGYNATHMFRVAEEFFTS
LGLLEMPPEFWDKSMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEM
GHVEYYLQYKDQPVSFRRGANPGFHEAIGDVLSLSVSTPKHLHSIDLLDQLTDDAESDIN
YLLKMALEKIAFLPFGYLIDQWRWSVFSGETPPDRYNADWWYLRTKYQGICPPTRRTEEH
FDAGGKYHIPGNTPYIRYFVSFILQFQFHEKLCKEAGHTGPLHKCDIYKSREAGAVLEKV
LKAGSSEPWTQVLQEALGTDKMDATPLMSYFLPVTTWLREQNEKTGETLGWPDFNWVPPI
PEGYPEDIGKITDEMQAKQFLDEYNSTAEEVWNAYTESSWTYNTDITEAHKDNMLQKNLE
MANHTKIYGLEARKYDTSDFQDESVKRILSKLSDLERAALSAEDLVEYNNLLASMETLYS
VATVCKDKSNCLPLDPDLNKIMAESRDYDELLFAWQGWRNASGREIRDSYKRYVELANSA
AKSNGHTDNGAFWRSLYETPTFEQDLEALWKDLEPLYLSVHAYVRRALYKKYGPERINLK
GPIPAHLLGNMWAQTWSGIMDLVNPYPDATQVDATPAMIAQGWTPKRMFEESDRFFTSLG
LLPMPPEFWNKSMLEKPTDGREVVCHASAWDFYNRKDFRIKQCTVVTMDDLITVHHEMGH
VQYFLQYKDQPISFRDGANPGFHEAIGDVLALSVATPKHLQSIGLLDKVEDNAESTINFL
MSIALDKIAFLPFGYLMDQWRWKVFDGRISSSEYNKEWWNLRMKYQGLCPPVPRTEKDFD
PGAKFHIPANVPYIRYFVSFVIQFQFHKGLCDAAGHKGPLHNCDIYQSKEAGKLLSDVMK
MGFSKPWPEAMKIITGQPKMSVQPLMEYFKPLIEWLEKENEKNGDVLGWPEYDWTPYKLS
TVVEESPKSVNFLGLSVDAAGAAAGQWILLVLSIVFLLAVVFLAYRYSKTKRLQNKSMSQ
MELK

BLAST