GenomeNet

>dre:566581 K05619 transglutaminase 1 [EC:2.3.2.13] | (RefSeq) tgm1l1; protein-glutamine gamma-glutamyltransferase K (A)
MPGERQSIRDNSAVGRFHGVSARNGEAVAEKPSESKTKKPESGCRRWLRKACPCCLRRQS
NSYDLTSEADGVVAGNEEIEQPASPVSVSVETNVDDLSLVVRSVDLLSRKTDRNKKEHHT
DQYSGDQLIIRRGQTFQIELELSRPFNPNTDKLHLELKTGALPLVSKGTHIIIPLVEELQ
DERWEAKIVEQNLNRAKLSINSSVNAVIGKYTLTVVTQCLKTNESTTHDPEKDIYMLFNP
WCEDDAVFMEGERELNEYVLNDTGRIYYGTEKQIGARTWNFGQFDEGILEACLFVLDNSE
VPPSGRGDPVNVVRVISAMINSPDDRGVLEGNWSGNYTGGTSPTAWSGSVEILKQYHREG
GTPVKYGQCWVFSGVTTTVLRCLGIPARSVTNFQSAHDTDVSLTTDVYFDEDMEPIHHLN
SDSVWNFHVWNDCWLARPDLPPGFGGWQAVDSTPQETSHGTFRCGPASLAAVRSGQVYLK
YDVPFVFAEVNSDKIYWQRNLDGTFSQIHSEKKAVGHCISTKAVGSDERVDITDVYKYPE
GSEEERIAVETACRYGSKPDVYSSAMAEDVQVEVRMEGEGPRMGGDAQLKIVVKNMSSQP
RRTTLHSQAAVMYYTGVLKDTVKKDKLSVELMPQEEKVIEWTLPYTQYQNQLVDQAALML
TLSGRVSETQQVLANQTSFRLRTPDLQIEPIGEAYVGKEASAKISFTNPLPCTLRNVVVR
VEGLGLRDLHPIKVGDVGKHGKVMVTEHFIPSIAGERKLVASLDCKQLTQVHGVADIIVH
ESQ

BLAST