GenomeNet

>dre:567970 setd1ba, im:7156157, si:dkey-237o15.4; SET domain containing 1B, a (EC:2.1.1.43); K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MCWKVEIVVYCKRQKPQTRGTQYVPGERNKLNEDHGRRQSSSLANGMDNSHPICSSGEKR
SHHWRSYKLIIDPALKKGSHKVYRYDGHQFSTPSFGMSPVDIVRDPRIGRLWTKYKETDL
PVPKFKIDECYVGRVPPKEVTFAKLNDNVREGFLTDMCKKFGDIEEVEILYNPKNKKHLG
IAKVVFETVKAAKDAVQNLHNTSVMGNIIHVELDPKGENRQRYFQRLINGSYTPLTLPVG
GEEACDVSPRSLAEALMACEPSRRLFEGGSSVVAGTTPSGTNTPMSLDTAYSSLRQDTPQ
SQGTPHTPRPSGTPFSQDSSYSSRQGTPAFQANRAESSGGYKSRRHETKFQDAYNRRPER
RYVHGPTQRGNTEQPPSFKQHQPPEPPSPAFTHTPPPPTSANFKTAYSQYQPPIPQEYTV
ASYHQPVQRELDYRRPPQAPPPPSTDFLPVRDRPTTPPIPEPPPAPETQPTTPPSSTPEP
CPSPTQESERNSLDSRIEMLLKPFLNERGDSDAEVRMDGSPISSSSSQLSPIPPQRPSRP
SSTGLEDISPTPLPDSEDDEPIRGTASLLANSRGMSPTNMHSKSCVGEPRTAIDKMDTGH
QSSGEDMEISDDEMPGTPIASGDCDKNIVVNSALSLIQTIPMPPPGFPPLPHAAGFPLPP
HHLPHHSTVSHLPSHHPMLHPLHSYGMMHFLPVDLLSSLPQLLQMPFQMQTQMLSRMAQS
QHPYAYPYPAPSANPAAMPFGGPYPPLSVVSAPADTLHGQPWPLPSMPQFNPAVPPPGYE
PQKEDPHKATIDGVLMAIVKELKAIMKKDLNRKMVEVVAFRKFDEWWDKQELSAKATLTP
VKTGEGKDEEKERAKPKETMSSHLPWNKGEGLGFEGMGLGIGLRGIRLPSFKVKRKQPPE
PTSTSDNKRVRPSTPVDDELEDEESERMGRTDGSRVDPAGSSSKRRPARPLELDSEGEEE
EETSGKEESSLSDHEEEPVDDASERLSSGKDLEEEDEKKSESHSSESESSDSSDDEASSS
SSSKSGSDSSGSESSSDYESSSEEEEEEEEEEERIVGMDDEEDVDARTSTSSSTTSTSSS
DEEEVVEVKAPSTPTGPPPEEEPNELGRLEAVDEAEIDHKPSMVSLIKTKVEEVRPPSPK
GLPADELDVDLEVKIPVPKTEASLEEVGNLRPPTPTGSFADSDQDTRPKIPTEDFPRTPG
HEGPVPLESETTVPRSLPTPSMHLPLPPSHVPDPQSLLPPPETLPDMPVRGRLPTEEDIP
RTPGRDLMDRARGLGKLQSTDTVPVTPGSDTPLTGNSLSSPHILGSPFSYPAQSPVLSAG
IPRTPGRDLTFAPAFPDSAGLSAGLPIHRKASSEILEEKPLFKEPLLSASPQASLPNNAA
SSPFPGPPLPTASLPEPALPPQGSPPASIENSFPASPKELPVPMIDVPVPLDDTPSKKKL
VRSKNKKGIQDSEEPQVTLIEASSLPELPVNNQYPDLPSESIKEEDGEPAFSEKEESQVP
TIIPKVEETSFYVEEPIQKTRRQRRGWQELLLSMHSPVASPRRPSFMPRSDFEEMTILYD
IWNDGIDEEDIRYLKITYDKMLQQDNAHDWLNDTLWVHHPPTNMGSATGVKKKRKEDGIR
DHVTGCARSEGYYKIDKKDKMKYLNSSRLQSEEPDVDTQGKSIPAQPQVSTRAGSERRSE
QRRLLSSFSCDSDLLKFNQLKFRKKKIRFCRSHIHDWGLFAMEPIAADEMVIEYVGQNIR
QVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQ
KKIVIYSRQPINVNEEITYDYKFPIEDEKIPCLCGAENCRGTLN

BLAST