GenomeNet

>dre:751629 setd8a, set8a, wu:fj33f02, zgc:153719; SET domain containing (lysine methyltransferase) 8a (EC:2.1.1.43); K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] (A)
MFPAVNEIKVQTWRRDQRGECPRRSAQCRLFSCAHRECAPAARSLENRGPENRTARPEAT
MSGDVLCNGHSAFHRLLKHSSSRTHEALVVKIIQENKNTPLFCTAPEPRRDSGVNGEFLL
NSAELQDEQTLPLHCIHSAADITSSKHRKPARRKVKRSTKRAAESKSPANRKVTDYFPIR
RSSRKSKSELKYEEKQHIDTLISNGIEDGMMVRFIEGKGRGVFATQPFQKGQYVVEYHGD
LLQITDAKQREALYAQDPSTGCYMYYFQYLSKTYCVDATKESDRLGRLINHSKNGNCQTK
LHAIAGKPHLILVASRDIQEGEELLYDYGDRSKSSIEAHPWLKH

BLAST