GenomeNet

>dre:751629 K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] | (RefSeq) setd8a, kmt5aa, set8a, wu:fj33f02, zgc:153719; SET domain containing (lysine methyltransferase) 8a (A)
MFPAVNEIKVQTWRRDQRGECPRRSAQCRLFSCAHRECAPAARSLENRGPENRTARPEAT
MSGDVLCNGHSAFHRLLKHSSSRTHEALVVKIIQENKNTPLFCTAPEPRRDSGVNGEFLL
NSAELQDEQTLPLHCIHSAADITSSKHRKPARRKVKRSTKRAAESKSPANRKVTDYFPIR
RSSRKSKSELKYEEKQHIDTLISNGIEDGMMVRFIEGKGRGVFATQPFQKGQYVVEYHGD
LLQITDAKQREALYAQDPSTGCYMYYFQYLSKTYCVDATKESDRLGRLINHSKNGNCQTK
LHAIAGKPHLILVASRDIQEGEELLYDYGDRSKSSIEAHPWLKH

BLAST