GenomeNet

>dre:793046 K12357 sialidase-2/3/4 [EC:3.2.1.18] | (RefSeq) neu3.4; uncharacterized protein LOC793046 (A)
MAYSSSHSAPPEISILFKQEPPLGKKQVTYRIPALIYISDKQTFLAFAEKRKTPSDTDAD
VLVMRKGLWKNDNQVEWVSDQQVFTSACLPNHRSMNPCPVYERESKNLFLFFICVPLGVS
ERKQIKENKNQARLCYITSKDTGETWSAVSDLTADVIGEQEKNWATFAVGPGHGVQMKSG
RLIIPAYTYRYTDKPVCTLCCCLSFCTPYALAFYSDDQGITWKAGQQMDVESCECQMAEI
VGEKGDSTLYCNARTRLGYRTEALSNNAGEDFDTVLSSSKLMETGKGCQGSVLSFLEQSS
PPQTWLLYSHPSHPKKRVDLGLYLNKSPLDSSGWSDEPLMILHHGPSAYSDLVEFEPGHF
ACLMECGKEYENEEIVFLLFKLPEKKL

BLAST