GenomeNet

>dre:796436 K01229 lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62] | (RefSeq) lct; lactase-phlorizin hydrolase isoform X1 (A)
MMKILGVFLSLGVLAIFWSYSNADEQEFMLLAGPLTTSKTLHLEEQYVFNCGGPLPQQSK
DYFLYLQRRGVTNFKVPLSWSHILPTGDANQPHEETVMCFKTLVQQLTESGIKPLLVLHR
SAVPELFRAKYGGWENPLLVQMFEQYAGFVFSTFRDHVDTFVTFSHLHELQDRQLKNALQ
SHENAYKVCHQRFTGLRLSLGIKASDVTSIHQMGSKIKTHVDFLSVHMQFNCKMQTALTE
ELRKVQIVSGQKSLLIYQLTVNDCDGYEHGFEARTGILGVLQNEGHHIIGCDITYVFEEL
DYEETLSLQKENTKIHQKSASAFSYQKVWEKFKSQTEAERDQFLSGSFPVDFQWSVSSES
FKVEGGSAEHGKGETIWDRFNHEAGVNESILGCDSYHKVDYDVYLLRGMMAPNYQFSISW
ARIFPTGRKESFVEKGAAYYDKMINTLLQSGIEPTVTLHHWDLPQALQESGGWTNDSIVE
AFKEFSDFCFSRYGDRVKSWITFGSPWVVSSLGYGTGEYPPSIKDPVSASYKVTHNILKS
HAEAWHIYNDKYRKLYGGKVGIALNSDWAEPRDPSSDQDVAAAERYLNFMLGWFAHPIFV
DGDYPAVLREQIEKKKELCTQDLARLPVFTEAEKQRIRGTADFFGLNHQTSRLISENLTS
CDAGPDNVGDFQAHIDPTWPTTASDQIQSVPWGLRRLLYYIFLEYTSITKVPIYITGNGM
PTEYTGDGINDTLRVDYLKAYINEAMKAVHLDDVVVQRFTVQSLMDGYEGPPGYTQRFGL
HYVNFDDPDRPRTPKASAYYYSKVIERNGFAETAASPKMHIRGNQVESRRLPSLPPSQVP
SKSKVVWEKFSPQTKFERQLYHYGTFSEGFQWGVSSSAYQVEGGWNADGKGPSVWDTFTQ
KPGNIPNNANGDVACDSYNKVDEDLHMLRALKVKTYRFSLSWSRIFPNGYKSSLNQKGVD
YYNRLIDGLIANNITPMVTLYHWDLPQALQNINGWDNTEMVSIFNEYCDFCYATFGDRVK
FWITFNEPQTIAWLGYGLGQIPPNVKQPGDAPYRVAHNLLKAHAQAYHTYDEKYRASQGG
LVSISLNAEWAEPLDVNIPREVEAADRALQFQLGWFAHPIFKNGDYPDAMKWQVGNKSEL
QGLKESRLPSFTSQDKAFIQGTADVFCINTYTTKVMRHVTSRLNIESYQTDQDIEKDNAD
SYEDTAVSEQKAVAWGLRRLLIWLKEEYGNPEIYITENGVATSTAFTTDDTDRIFYLKTY
VDEALKAHNLDGVRVKGYIASSLMDSFEWLNGYNVGYGLHHVDFKHSSRPRTPKRSAHFY
FDIIRNNGFPITAEEEILYGHFREGFEWSTATAAYQIEGAWRADGKGLSIWDKFSHTDSK
ITQDDNGDIACDSYNKIEEDINVLKTLGVKHYRFSISWPRILPDGTNRKINEAGLDYYHR
LTDALLAANIKPQVTLYHWDLPQALQDVGGWENDTIVDRFRDYADVVFNSLGEKIKFWIT
LNEPLNVAAHGYGYGSQAPGLSDSPGTAPYTVAHNLIKAHAEAWHLYNDQYRAKHGGMIS
LTMNSDWAEARNPYKQEDVDAARRTIQFQLGWFAHPVFKGDYSDLMKDVIRERSLAAGLP
KSRLPEFTPEEVARIKGTHDYFGFNHYTSVLAFNVDYGDQQHIEADRGAGAIRDRTWLDS
GSIWLKVAPVGFRKILNFIKEEYGNPPLYITENGVSEQGPENLNDVTRIYYYENYINQAL
KAYMLDGVDIRGYTAWSLMDNMEWAAGYTERFGLFYVNRSDPNFPRIPKKSVWSYATIVS
CNGFLSPEERPHKCEVHEPEDDIPGITTLPPPVEELSVSFLGLEVSVSNAELGLNVLFSL
TFIAAVTVIFLVFGLVRTSKKQRRPAGEHIELAKEDKF

BLAST